upon completion of a program at a vocational school, students earn a

Answers

Answer 1

Answer:

The anser would be certifacate or licence :)

Explanation:


Related Questions

Should the US provide legal residency status to Dreamers?

Topic


Evidence


Description

Answers

The United States should provide legal residency status to Dreamers. Dreamers are immigrants who were brought to the United States as children. They have lived in the United States for many years, and consider themselves to be American. Dreamers have contributed to the United States in many ways, and their deportation would be a loss to the country.The United States has a history of providing legal status to immigrants who have made significant contributions to the country. Dreamers have made significant contributions to the United States, and their deportation would be a loss to the country. The United States should provide legal status to Dreamers in order to allow them to continue to contribute to the country.

What do you mean by legal residency?

Legal residency is a status granted to a person who is not a citizen of the country in which they live, but who has been given permission to live and work there.

To learn more abouy legal residency

https://brainly.com/question/1657374

#SPJ13

Which statement best describes a situation in which scientists would have confidence in a scientific theory?

Answers

Answer:

Many tests have been done, and all of the results support the theory.

Explanation:

"A scientific theory is a well-substantiated explanation of some aspect of the natural world, based on a body of facts that have been repeatedly confirmed through observation and experimentation.

In ASL, the correct order to sign the words "Hi, how are you?" is "Hi, you how is?"

Answers

Answer:

Technically, no.

Explanation:

In ASL, you sign "Hi, how are you?" by using the signs, "Hi", "How", and "you". So it would be "Hi, How you?

If you wanted too find the jet stream where would you go

Answers

Answer:i honestly don’t know

Explanation:

Answer:

i met u in califonya you said you loved him in gorgia  your herat is frozen over in supernova

Explanation:

What Is 3354 X 5 +339


Thanks

Answers

The asnwer is 17,109

Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1

1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt


Part 2

1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)

Part 3

Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms







Part 4

Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.


Part 5

Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.

Answers

The appropriate verbs for the given sentences are given below:

Part 1

waswas lyingwouldfeels

Part 2

were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould be

Part 3

hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshave

Part 4

1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.

Part 5

itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheir

What is a Verb?

This refers to the part of speech that shows action in a given sentence.

Hence, the words have been correctly selected above from the four different parts of the question.

Read more about verbs here:

https://brainly.com/question/1718605

#SPJ1

Other Questions
statistics classifying samples (I am not sure if this is B or C) The diagram below shows many of the processes involved in the carbon cycle. Which of the processes shown releases carbon into the atmosphere? Find m1 I need help please Find the length of side x to the nearesttenth. What group was formed in the late 1800s to help the interests of farmers? A. The American Temperance Society B. The Knights of Labor C. The American Colonization Society D. The Grange educating managers and employees about the numerous professional, personal, and societal advantages inherent in recognizing the worth of all employees without regard to gender or race is goal of Shawn pays a rate of 35.55 mills in property tax on a home with an assessed value of $63,500. What is his property tax? draw and label tape diagram to model each number sentence Explain why the product of 20 x 30 is equal to 600.BIU A new born child receives a $8,000 gift toward a college education from her grandparents. How much will the $8,000 be worth in 17 years if it is invested at 72% compounded quarterly?It will be worth $(Round to the nearest cent) top question says: Triangle ABC can be taken to triangle A'B'C' using rigid motions and a dilation. help me pls If 42.6 grams of Al reacts completely with O2 and 57.8 grams of Al2O3 produced, what is the % yield of Al2O3for the reaction? 4Al + 3O2 --------> 2Al2O3Group of answer choices22.3%65.9%55.7%75.2%71.8% matt is supervising the installation of redundant communications links in response to a finding during his organization's bia. what type of mitigation provision is matt overseeing? PLS HELP FIND CONTOUR INTERVAL N ILL MARK BRANLIEST!! Directions: Study the contour map below. Using the contour map and what you learnedfrom the lesson, complete the questions below. When your report is finished, submit it tothe Topographic Maps Lab dropbox for grading. This assignment is worth 20 points. Reabsorption of fluid into the capillary takes place at the arterial end or venous end of the capillary?. Solve the quadratic equation x2 6x + 13 = 0 using the quadratic formula. What is the solution when expressed in the form a bi, where a and b are real numbers? The first part of the function rule for the values in the table below is Y equals X over two. What is the complete function rule? a phagehunter plates 400 phage particles onto a pyca plate with gordonia terrae. the burst size of the phage is 50 phage particles per round of replication. after three rounds of replication, how many phage particles are present on this plate? Real number between 0 and 6 will be picked according to the probability distribution shown in the figure. Regions under the curve are liable with A, B, C, and D. The area of each is shown in the table. Use the figure and table to answer the parts The graphs of the functions g and h are shown below. For each graph, find the absolute maximum and absolute minimum. If no such value exists, click on "None".Assume that the dashed line shown is a vertical asymptote that the graph does not cross.